A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10891 |
Swiss-prot Accession number | P67971 (Sequence in FASTA format) |
Description | Insulin [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Saimiri sciureus (Common squirrel monkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Platyrrhini; Cebidae; Saimiriinae; Saimiri. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 51 Amino acids |
Molecular weight | 5747 |
References | 1 PubMed abstract 2263627 |
Domain Name | Insulin |
Hormone Name | Insulin B chain |
Mature Hormone Sequence | FVNQHLCGPHLVEALYLVCGERGFFYAPKT |
Position of mature hormone in Pre-Hormone protein | 30 Residues from position (1-30) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10892 |
Swiss-prot Accession number | P67971 (Sequence in FASTA format) |
Description | Insulin [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Saimiri sciureus (Common squirrel monkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Platyrrhini; Cebidae; Saimiriinae; Saimiri. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 51 Amino acids |
Molecular weight | 5747 |
References | 1 PubMed abstract 2263627 |
Domain Name | Insulin |
Hormone Name | Insulin A chain |
Mature Hormone Sequence | GVVDQCCTSICSLYQLQNYCN |
Position of mature hormone in Pre-Hormone protein | 21 Residues from position (31-51) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11123 |
Swiss-prot Accession number | P68275 (Sequence in FASTA format) |
Description | Glucagon. |
Source organism | Saimiri sciureus (Common squirrel monkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Platyrrhini; Cebidae; Saimiriinae; Saimiri. |
Subcellular location | Secreted (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis |
Protein Length | 29 Amino acids |
Molecular weight | 3483 |
References | 1 PubMed abstract 2263627 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon |
Mature Hormone Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNT |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (1-29) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |